PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.9N5S4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 338aa    MW: 39021.9 Da    PI: 6.3233
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.9N5S4genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.4e-56101391129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv+++k+el +vik+vd+yk+ePwdL++  ++   ee+ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s 
  Araip.9N5S4  10 VPPGFRFHPTDEELVDYYLRKKVSSRKIEL-DVIKDVDLYKIEPWDLQEicRIGReEENEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS- 105
                  69****************************.9***************954544332666**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Araip.9N5S4 106 KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 139
                  8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-577144IPR003441NAC domain
PROSITE profilePS5100555.22810163IPR003441NAC domain
PfamPF023657.4E-2911138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MENMNSFCHV PPGFRFHPTD EELVDYYLRK KVSSRKIELD VIKDVDLYKI EPWDLQEICR  60
IGREEENEWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KAIYSKHDLI GMRKTLVFYK  120
GRAPNGQKSD WIMHEYRLET DENAAPQAIF KKRVTTMRKM MMREHDESPN SSCWYDDQEF  180
MMMESPTKQQ SSILLHQSTN NHSNLMQLPP YPLIKKELHH PSSSSSSYPF LQLPLLESHQ  240
QSAAAPSSIS EQLIMPPPIG GGEQVPSFQS FFNNEQQEVG VLDWRVLDKF VASQLSQDDN  300
HASSNSIVQD LTQEIVMVPH NDAASTSNSL TSPIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48913814140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016188089.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-113NAC7_ARATH; NAC domain-containing protein 7
TrEMBLI1L5Q51e-135I1L5Q5_SOYBN; Uncharacterized protein
STRINGGLYMA09G36600.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-98NAC 007